Research / Customization / Sales
PNC-27
PNC-27 is a designed peptide containing a p53-related segment and a cell-penetrating component, investigated in HDM-2-associated cell models.
- Specification
- 5mg × 10 vials
- Catalog code
- PN5
- Material category
- Peptide
Choose a contact to discuss this specification, quantity or customization.
For laboratory research use only. Not for human use.
The research context
A closer look at PNC-27.
p53/HDM-2-related interactions and cell-membrane assays
Technical Details Product information
PNC-27
- short sequence
- PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- CAS
- 1159861-00-3
- mass
- 4031.73
- formula
- C188H293N53O44S
Storage: Powder: -80°C for 2 years or -20°C for 1 year. Solution: -80°C for 6 months or -20°C for 1 month. Keep sealed; protect from moisture.
FAQ
PNC-27 questions
What is PNC-27?
PNC-27 is a designed peptide containing a p53-related segment and a cell-penetrating component, investigated in HDM-2-associated cell models.
Which specifications and packs are listed?
5mg × 10 vials; 10mg × 10 vials.
Can I request a different specification?
Yes. Contact our team on WhatsApp or Telegram to discuss specifications and customization.
Where can I view its COA?
This product is undergoing testing. Its COA will be added when available.
Let's discuss your specification
Make PNC-27 part of your project.
Your enquiry includes the selected specification and catalog code.