Research / Customization / Sales
LL37
LL-37 is a human cathelicidin-derived antimicrobial peptide examined in microbial and host-response models.
- Specification
- 5mg × 10 vials
- Catalog code
- 375
- Material category
- Peptide
Choose a contact to discuss this specification, quantity or customization.
For laboratory research use only. Not for human use.
The research context
A closer look at LL37.
Antimicrobial-peptide interactions and innate-immune signaling
Technical Details Product information
LL-37, human
- sequence
- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
- short sequence
- [LL-37, 37 aa]
- CAS
- 154947-66-7
- mass
- 4493.26
- formula
- C205H340N60O53
Storage: Powder: -80°C for 2 years or -20°C for 1 year. Solution: -80°C for 6 months or -20°C for 1 month. Keep sealed; protect from moisture, light; under nitrogen.
FAQ
LL37 questions
What is LL37?
LL-37 is a human cathelicidin-derived antimicrobial peptide examined in microbial and host-response models.
Which specifications and packs are listed?
5mg × 10 vials.
Can I request a different specification?
Yes. Contact our team on WhatsApp or Telegram to discuss specifications and customization.
Where can I view its COA?
This product is undergoing testing. Its COA will be added when available.
Related research materials
From the same research collection.
Selank
Selank is a synthetic tuftsin-related peptide investigated for neurochemical and stress-response effects in experimental models.
View Product
Thymosin alpha 1
Thymosin alpha 1, also called thymalfasin, is a thymic-peptide-related immunomodulatory research material.
View Product
KPV
KPV is the tripeptide Lys-Pro-Val, corresponding to a short C-terminal region of alpha-MSH.
View ProductLet's discuss your specification
Make LL37 part of your project.
Your enquiry includes the selected specification and catalog code.