Research / Customization / Sales
IGF-1 LR3
IGF-1 LR3 is a modified insulin-like growth factor-1 analogue distinguished by an N-terminal extension and an Arg substitution at position 3.
- Specification
- 100mcg × 10 vials
- Catalog code
- IG01
- Material category
- Peptide
Choose a contact to discuss this specification, quantity or customization.
For laboratory research use only. Not for human use.
The research context
A closer look at IGF-1 LR3.
IGF-receptor signaling and cell-growth assays
Technical Details Product information
Human LR3 IGF-1, E.coli
- mass
- 9.1 kDa (83 aa)
- sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- form
- 83-aa LR3 analogue; E.coli-expressed
Storage: Dry -20 to -80°C for one year; aseptically reconstituted 2–8°C for one month or frozen working aliquots -20 to -80°C for three months.
FAQ
IGF-1 LR3 questions
What is IGF-1 LR3?
IGF-1 LR3 is a modified insulin-like growth factor-1 analogue distinguished by an N-terminal extension and an Arg substitution at position 3.
Which specifications and packs are listed?
100mcg × 10 vials; 1mg × 10 vials.
Can I request a different specification?
Yes. Contact our team on WhatsApp or Telegram to discuss specifications and customization.
Where can I view its COA?
This product is undergoing testing. Its COA will be added when available.
Related research materials
From the same research collection.
BPC 157
BPC-157 is a synthetic pentadecapeptide examined in cell and preclinical studies of tissue-response signaling.
View Product
Sermorelin
Sermorelin is a synthetic analogue of the active 1-29 region of growth hormone-releasing hormone, with activity at the GHRH receptor.
View ProductLet's discuss your specification
Make IGF-1 LR3 part of your project.
Your enquiry includes the selected specification and catalog code.