Research / Customization / Sales
Cagrilintide
Cagrilintide is a long-acting acylated amylin analogue studied at amylin and calcitonin-family receptors.
- Specification
- 2mg × 10 vials
- Catalog code
- CGL2
- Material category
- Peptide
Choose a contact to discuss this specification, quantity or customization.
For laboratory research use only. Not for human use.
The research context
A closer look at Cagrilintide.
Amylin/calcitonin-family receptor pharmacology
Certificate of Analysis
Cagrilintide
- Sample
- Cagrilintide
- Spec.
- Cagrilintide 10mg
- Laboratory
- Horizon Analytical
- Report ID
- 1031278
- Analysis date (as printed)
- 10/03/2026
Technical Details Product information
Cagrilintide
- CAS
- 1415456-99-3
- formula
- C194H312N54O59S2
- mass
- 4409.01
- sequence
- {Eicosanedioic acid-gamma-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (disulfide-linked)
- solubility
- H2O 100 mg/mL (22.68 mM; sonication)
Storage: Powder: -80°C for 2 years or -20°C for 1 year. Solution: -80°C for 6 months or -20°C for 1 month. Sealed, protected from moisture and light; under nitrogen.
FAQ
Cagrilintide questions
What is Cagrilintide?
Cagrilintide is a long-acting acylated amylin analogue studied at amylin and calcitonin-family receptors.
Which specifications and packs are listed?
2mg × 10 vials; 5mg × 10 vials; 10mg × 10 vials.
Can I request a different specification?
Yes. Contact our team on WhatsApp or Telegram to discuss specifications and customization.
Where can I view its COA?
Select View COA on this product page or browse Quality & COA.
Related research materials
From the same research collection.
Semaglutide
Semaglutide is a long-acting peptide agonist of the glucagon-like peptide-1 receptor (GLP-1R).
View Product
Retatrutide
Retatrutide is an investigational peptide agonist of GLP-1, GIP and glucagon receptors.
View Product
Mazdutide
Mazdutide is a synthetic oxyntomodulin analogue with activity at GLP-1 and glucagon receptors.
View ProductLet's discuss your specification
Make Cagrilintide part of your project.
Your enquiry includes the selected specification and catalog code.