Research / Customization / Sales
ACTH 1-39
ACTH 1-39 is the full 39-residue adrenocorticotropic-hormone peptide.
- Specification
- 5mg × 10 vials
- Catalog code
- ACTH1
- Material category
- Peptide
Choose a contact to discuss this specification, quantity or customization.
For laboratory research use only. Not for human use.
The research context
A closer look at ACTH 1-39.
Melanocortin-receptor and adrenal-axis signaling
Technical Details Product information
Adrenocorticotropic Hormone (ACTH) (1-39), human acetate
- sequence
- Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
- short sequence
- SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
- mass
- 4541.14 (free base)
- formula
- C207H308N56O58S.xC2H4O2
FAQ
ACTH 1-39 questions
What is ACTH 1-39?
ACTH 1-39 is the full 39-residue adrenocorticotropic-hormone peptide.
Which specifications and packs are listed?
5mg × 10 vials.
Can I request a different specification?
Yes. Contact our team on WhatsApp or Telegram to discuss specifications and customization.
Where can I view its COA?
This product is undergoing testing. Its COA will be added when available.
Related research materials
From the same research collection.
Sermorelin
Sermorelin is a synthetic analogue of the active 1-29 region of growth hormone-releasing hormone, with activity at the GHRH receptor.
View Product
Tesamorelin
Tesamorelin is a modified GHRH analogue investigated in endocrine and metabolic research.
View Product
GHRP-6 Acetate
GHRP-6 Acetate is a growth-hormone secretagogue peptide studied at the ghrelin receptor.
View ProductLet's discuss your specification
Make ACTH 1-39 part of your project.
Your enquiry includes the selected specification and catalog code.